CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • CutDB - Proteolytic Events Open Annotation Database
    Welcome to CutDB

    The CutDB focuses on the annotation of individual proteolytic events, both actual and predicted.

    Protease definition Substrate definition Cut site Updated by Updated on
    Frizzled 1 AAAHHHHHHGSGSGLNDIFEAQKIEWHEGSQYNGERGISVPDHGYCQPISIPLCTDIAYN QTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSL CERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTGNSLEVLFQGPGG SGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAK alpo6411 Wed Dec 20 Detail
    ADAM28 peptidase CD200 antigen isoform a precursor MHMH Tue Mar 21 Detail
    ADAM28 peptidase CD200 antigen isoform a precursor MHMH Tue Mar 21 Detail
    endo-alpha-N-acetylgalactosaminidase DennisKH Mon Jan 16 Detail
    Protein rbruntz Fri Sep 23 Detail
  • Citing PMAP-CutDB
  • If you find PMAP-CutDB useful, please consider citing the following article that describes this work.
  • CutDB: a proteolytic event database
  • Igarashi Y., Eroshkin A., Gramatikova S., Gramatikoff G., Zhang Y., Smith J.W., Osterman A.L., Godzik A.
  • Nucleic Acids Res. 2007 [ PMID: 17142225 ]