PathwayDB: a proteolytic pathway database
  • User: anonymous [ Log in ]
  • Welcome to PathwayDB

    The PathwayDB focuses on the reconstruction, modeling and curation of proteolytic pathways.

    Recently updated event-driven models
    Pathway names Description Involved proteases Creator Updated on
    new network MGSTAILGLLLAVLQGGRAQVQLQESGPGLVKPSQTLSLTCTVSGGSISSGAYYWTWIRQHPGKGLEWIGYIYYS ... cathepsin L-like peptidase drock Thu Oct 25 Detail
    MMP-1 proteolytic network proteolytic network of human matrix metallopeptidase-1 - 39 events matrix metallopeptidase-1 alexeye Fri Mar 13 Detail
    mmp-26 substrates mmp-26 substrates and protein-protein interactors matrix metallopeptidase-26 alexeye Tue Dec 30 Detail
    Calpain-1 network #1 Calpain-1 and 6 substrates were selected. calpain-1 YI Tue Aug 19 Detail
    MMP-2 network #1 MMP-2 and 5 substrates were selected. matrix metallopeptidase-2 YI Tue Aug 19 Detail
  • Notice
  • Current PathwayDB (beta) is in its initial stage. The data/format will be changed/erased without notice.