CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: BCL2-associated X protein isoform alpha
    Symbol: BAX
    Organism: Homo sapiens
    NCBI Accession: NP_620116
    SubstrateDB: 16103
    UniProt Accession: Q07812
    [Sequence on/off]
    MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDEL
    DSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWT
    LDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: FIQD-RAGR
    Position: 33-34
    Protease
    Definition: calpain-1
    Organism: Homo sapiens
    MEROPS ID: MER000770
    PMAP ID: pmap.21406
    MEROPS code: C02.001
    Original citation
    Comments and others