CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: alpha1-antichymotrypsin (Homo sapiens)
    Symbol: SERPINA3
    Organism: Homo sapiens
    NCBI Accession: NP_001076
    SubstrateDB: 16214
    UniProt Accession: P01011
    [Sequence on/off]
    MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPD
    KNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNA
    MFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLINDYVKNGTRGKITDLIKDLDSQTMMVLVNY
    IFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILPD
    QDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGAR
    NLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP
    KQA
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: NQDR-GTHV
    Position: 41-42
    Protease
    Definition: clostripain
    Organism: Clostridium histolyticum
    MEROPS ID: MER000831
    PMAP ID: pmap.21979
    MEROPS code: C11.001
    Original citation
    No_information
    Acknowledgment
    MEROPS_7.30
    Comments and others