CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: BCL2-like 1 isoform 2
    Symbol: BCL2L1
    Organism: Homo sapiens
    NCBI Accession: 4502381
    SubstrateDB: 16222
    UniProt Accession: Q07817
    [Sequence on/off]
    MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG
    HSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQDTFVELYGNNAAAES
    RKGQERFNRWFLTGMTVAGVVLLGSLFSRK
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: HLAD-SPAV
    Position: 61-62
    Protease
    Definition: caspase-1
    Organism: Homo sapiens
    MEROPS ID: MER000850
    PMAP ID: pmap.22029
    MEROPS code: C14.001
    Consequence
    Inactivation_complete
    Original citation
    Acknowledgment
    MEROPS_7.30
    Comments and others