CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: alpha1-antichymotrypsin (Homo sapiens)
    Symbol: SERPINA3
    Organism: Homo sapiens
    NCBI Accession: NP_001076
    SubstrateDB: 16547
    UniProt Accession: P01011
    [Sequence on/off]
    MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPD
    KNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNA
    MFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLINDYVKNGTRGKITDLIKDLDSQTMMVLVNY
    IFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILPD
    QDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGAR
    NLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP
    KQA
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: LLSA-LVET
    Position: 385-386
    Protease
    Definition: matrix metallopeptidase-3
    Organism: Homo sapiens
    MEROPS ID: MER001068
    PMAP ID: pmap.41854
    MEROPS code: M10.005
    Original citation
    Acknowledgment
    MEROPS_7.30
    Comments and others