CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
    Symbol: SERPINA1
    Organism: Homo sapiens
    NCBI Accession: NP_001002235
    SubstrateDB: 16660
    UniProt Accession: P01009
    [Sequence on/off]
    MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSN
    STNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGN
    GLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVN
    YIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPD
    EGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAP
    LKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK

    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: EAIP-MSIP
    Position: 381-382
    Protease
    Definition: matrix metallopeptidase-26
    Organism: Homo sapiens
    MEROPS ID: MER012072
    PMAP ID: pmap.06772
    MEROPS code: M10.029
    Consequence
    Inactivation_partial
    Method_of_ID
    N-terminal sequencing
    Original citation
    Acknowledgment
    MEROPS_7.30
    Comments and others