CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: cytochrome oxidase biogenesis protein Oxa1 (Saccharomyces cerevisiae)
    Symbol:
    Organism: Saccharomyces cerevisiae
    NCBI Accession: P39952
    SubstrateDB: 17165
    UniProt Accession: P39952
    [Sequence on/off]
    MFKLTSRLVTSRFAASSRLATARTIVLPRPHPSWISFQAKRFNSTGPNANDVSEIQTQLPSIDELTSSAP
    SLSASTSDLIANTTQTVGELSSHIGYLNSIGLAQTWYWPSDIIQHVLEAVHVYSGLPWWGTIAATTILIR
    CLMFPLYVKSSDTVARNSHIKPELDALNNKLMSTTDLQQGQLVAMQRKKLLSSHGIKNRWLAAPMLQIPI
    ALGFFNALRHMANYPVDGFANQGVAWFTDLTQADPYLGLQVITAAVFISFTRLGGETGAQQFSSPMKRLF
    TILPIISIPATMNLSSAVVLYFAFNGAFSVLQTMILRNKWVRSKLKITEVAKPRTPIAGASPTENMGIFQ
    SLKHNIQKARDQAERRQLMQDNEKKLQESFKEKRQNSKIKIVHKSNFINNKK
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: TRLG-GETG
    Position: 264-265
    Protease
    Definition: Oma1 peptidase
    Organism:
    MEROPS code: M48.018
    Original citation
    No_information
    Acknowledgment
    MEROPS_7.30
    Comments and others