CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: alpha1-antichymotrypsin (Homo sapiens)
    Symbol:
    Organism: Homo sapiens
    NCBI Accession: P01011
    SubstrateDB: 17228
    UniProt Accession: P01011
    [Sequence on/off]
    MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPD
    KNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNA
    MFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLINDYVKNGTRGKITDLIKDLDSQTMMVLVNY
    IFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILPD
    QDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGAR
    NLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP
    KQA
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: VKIT-LLSA
    Position: 381-382
    Protease
    Definition: neutrophil elastase
    Organism:
    MEROPS ID: MER000118
    PMAP ID: pmap.17376
    MEROPS code: S01.131
    Original citation
    No_information
    Acknowledgment
    MEROPS_7.30
    Comments and others