CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: connective tissue growth factor
    Symbol: CTGF
    Organism: Homo sapiens
    NCBI Accession: NP_001892
    SubstrateDB: 17938
    UniProt Accession: Q5M8T4
    [Sequence on/off]
    MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTE
    RDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMD
    VRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACS
    KTCGMGISTRVTNDNASCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYR
    AKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: ALAA-YRLE
    Position: 181-182
    Protease
    Definition: membrane-type matrix metallopeptidase-1
    Organism: Homo sapiens
    MEROPS ID: MER001077
    PMAP ID: pmap.41891
    MEROPS code: M10.014
    Method_of_ID
    Mass spectrometry
    Original citation
    Comments and others