CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: syndecan 1 precursor
    Symbol: SDC1
    Organism: Homo sapiens
    NCBI Accession: NP_002988
    SubstrateDB: 17955
    UniProt Accession: P18827
    [Sequence on/off]
    MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQL
    LTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEATPRPRETTQLPTTHQASTT
    TATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHTEDGGPSATERAAEDGASSQLPAAEGSGEQD
    FTFETSGENTAVVAVEPDRRNQSPVDQGATGASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKK
    KDEGSYSLEEPKQANGGAYQKPTKQEEFYA

    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: RLLG-LFGE
    Position: 1167-1168
    Protease
    Definition: membrane-type matrix metallopeptidase-1
    Organism: Homo sapiens
    MEROPS ID: MER001077
    PMAP ID: pmap.41891
    MEROPS code: M10.014
    Method_of_ID
    Gel electrophoresis
    Original citation
    Comments and others