CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: endothelin 1
    Symbol: EDN1
    Organism: Homo sapiens
    NCBI Accession: NP_001946
    SubstrateDB: 17990
    [Sequence on/off]
    MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLD
    IIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWN
    NHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRA
    HW
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: RSKR-ALEN
    Position: 92-93
    Protease
    Definition: furin
    Organism: Homo sapiens
    MEROPS ID: MER000375
    PMAP ID: pmap.18959
    MEROPS code: S08.071
    Consequence
    Activation_partial
    Pathway
    Secretory pathway
    Cell_compartment
    trans-Golgi network
    Tissue
    endothelial cell of aorta
    Disease
    Others
    Method_of_ID
    Others
    Original citation
    Comments and others