CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) isoform a
    Symbol: TFPI
    Organism: Homo sapiens
    NCBI Accession: NP_006278
    SubstrateDB: 18105
    UniProt Accession: P10646
    [Sequence on/off]
    MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRF
    FFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITR
    YFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFE
    FHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGL
    IKTKRKRKKQRVKIAYEEIFVKNM
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: PPLK-LMHS
    Position: 48-49
    Protease
    Definition: matrix metallopeptidase-9
    Organism: Homo sapiens
    MEROPS ID: MER001085
    PMAP ID: pmap.41924
    MEROPS code: M10.004
    Consequence
    Inactivation_complete
    Method_of_ID
    N-terminal sequencing
    Original citation
    Comments and others