CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: selectin L
    Symbol: SELL
    Organism: Homo sapiens
    NCBI Accession: NP_000646
    SubstrateDB: 18123
    UniProt Accession: P14151
    [Sequence on/off]
    MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNK
    AEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAG
    KWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDC
    THPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFS
    FTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAF
    IIWLARRLKKGKKSKRSMNDPY
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: No_information
    Position: No_information
    Protease
    Definition: matrix metallopeptidase-3
    Organism: Homo sapiens
    MEROPS ID: MER001068
    PMAP ID: pmap.41854
    MEROPS code: M10.005
    Original citation
    Comments and others