CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: matrix metalloproteinase 1 preproprotein
    Symbol: MMP1
    Organism: Homo sapiens
    NCBI Accession: NP_002412
    SubstrateDB: 18163
    UniProt Accession: P03956
    [Sequence on/off]
    MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF
    FGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQL
    WSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREY
    NLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDS
    KLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWA
    VQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
    GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: EKRR-NSGP
    Position: 55-56
    Protease
    Definition: chymotrypsin B
    Organism: Homo sapiens
    MEROPS ID: MER000001
    PMAP ID: pmap.16665
    MEROPS code: S01.152
    Consequence
    Activation_partial
    Method_of_ID
    N-terminal sequencing
    Original citation
    Comments and others