CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Small inducible cytokine a13 precursor
    Symbol: CCL13
    Organism: Homo sapiens
    NCBI Accession: NP_005399
    SubstrateDB: 18385
    UniProt Accession: Q99616
    [Sequence on/off]
    MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLG
    KEICADPKEKWVQNYMKHLGRKAHTLKT
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: ALNV-PSTC
    Position: 30-31
    Protease
    Definition: matrix metallopeptidase-1
    Organism: Homo sapiens
    NCBI GI: 4505215
    MEROPS ID: MER001063
    PMAP ID: pmap.41842
    MEROPS code: M10.001
    Consequence
    Activation_complete
    Disease
    Inflammation
    Method_of_ID
    Mass spectrometry
    Original citation
    Comments and others