CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: insulin-like growth factor binding protein 3 isoform a precursor
    Symbol: IGFBP3
    Organism: Homo sapiens
    NCBI Accession: NP_001013416
    SubstrateDB: 18528
    [Sequence on/off]
    MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCC
    LTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGEPPAP
    GNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSES
    KRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPG
    YTTKGKEDVHCYSMQSK
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: No_information
    Position: No_information
    Size of products 19kDa, --kDa
    Protease
    Definition: matrix metallopeptidase-19
    Organism: Homo sapiens
    MEROPS ID: MER002076
    PMAP ID: pmap.21835
    MEROPS code: M10.021
    Tissue
    keratinocyte of epidermis
    Cell_line
    HaCaT
    Method_of_ID
    Gel electrophoresis
    Original citation
    Comments and others