CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: insulin-like growth factor binding protein 5
    Symbol: IGFBP5
    Organism: Homo sapiens
    NCBI Accession: NP_000590
    SubstrateDB: 18558
    UniProt Accession: P24593
    [Sequence on/off]
    MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCALAEGQSCGVY
    TERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPK
    HTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMV
    PRAVYLPNCDRKGFYKRKQCKPSRGRKRGICWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: No_information
    Position: No_information
    Size of products 52kDa, --kDa
    Protease
    Definition: matrix metallopeptidase-1
    Organism: Homo sapiens
    MEROPS ID: MER001063
    PMAP ID: pmap.41842
    MEROPS code: M10.001
    Method_of_ID
    Gel electrophoresis
    Original citation
    Comments and others