CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_a_predicted.
    Substrate
    Definition: Coagulation factor ii receptor precursor
    Symbol: F2R
    Organism: Homo sapiens
    NCBI Accession: NP_001983
    SubstrateDB: 18991
    [Sequence on/off]
    MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYR
    LVSINK
    SSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVY
    MLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMQS
    LSWRTLGRASFTCLAIWALAIAGVVPLVLKEQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFF
    VPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAY
    FAYLLCVCVSSISSCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
    KKLLT
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: YRLV-SINK
    Position: 72-73
    Protease
    Definition: myeloblastin
    Organism: Homo sapiens
    MEROPS ID: MER000170
    PMAP ID: pmap.17515
    MEROPS code: S01.134
    Method_of_ID
    Others
    Original citation
    No_information
    Relevance
    C
    Comments and others