CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: tumor necrosis factor (ligand) superfamily, member 11
    Symbol: Tnfsf11
    Organism: Mus musculus
    NCBI Accession: NP_035743
    SubstrateDB: 19217
    UniProt Accession: Q3TWY5
    [Sequence on/off]
    MRRASRDYGKYLRSSEEMGSGPGVPHEGPLHPAPSAPAPAPPPAASRSMFLALLGLGLGQVVCSIALFLY
    FRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFS
    GA
    PAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQD
    GFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFF
    KLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: GPQR-FSGA
    Position: 138-139
    Protease
    Definition: ADAM17 peptidase
    Organism: Homo sapiens
    MEROPS ID: MER003094
    PMAP ID: pmap.02025
    MEROPS code: M12.217
    Original citation
    Comments and others