CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Bh3 interacting domain death agonist isoform 2
    Symbol: BID
    Organism: Homo sapiens
    NCBI Accession: NP_001187
    SubstrateDB: 19229
    UniProt Accession: P55957
    [Sequence on/off]
    MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLG
    RIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPR
    DMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: No_information
    Position: No_information
    Protease
    Definition: caspase-10
    Organism: Homo sapiens
    MEROPS ID: MER002579
    PMAP ID: pmap.25446
    MEROPS code: C14.011
    Method_of_ID
    Gel electrophoresis
    Original citation
    Comments and others