CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Bcl2-like 1
    Symbol: Bcl2l1
    Organism: Mus musculus
    NCBI Accession: NP_033873
    SubstrateDB: 19270
    UniProt Accession: Q64373
    [Sequence on/off]
    MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATG
    HSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI
    VAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERF
    NRWFLTGMTVAGVVLLGSLFSRK
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: WHLA-DSPA
    Position: 60-61
    Protease
    Definition: calpain-2
    Organism: Homo sapiens
    MEROPS ID: MER000964
    PMAP ID: pmap.22797
    MEROPS code: C02.002
    Consequence
    Inactivation_complete
    Method_of_ID
    N-terminal sequencing
    Original citation
    Comments and others