CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: insulin-like growth factor binding protein 2, 36kDa
    Symbol: IGFBP4
    Organism: Homo sapiens
    NCBI Accession: NP_000588
    SubstrateDB: 19292
    UniProt Accession: P18065
    [Sequence on/off]
    MLPRVGCPALPLPPPPLLPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPPVAPPAAVAAV
    AGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSELPLQALVMGEGTCEKRRDA
    EYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTEQHRQMGKGGK
    HHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLN
    GQRGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQEARGVHTQRMQ
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: No_information
    Position: No_information
    Protease
    Definition: pappalysin-1
    Organism: Homo sapiens
    MEROPS ID: MER002217
    PMAP ID: pmap.23149
    MEROPS code: M43.004
    Consequence
    Others
    Method_of_ID
    Gel electrophoresis
    Original citation
    Comments and others