CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: protein tyrosine phosphatase, non-receptor type 1
    Symbol: PTPN1
    Organism: Homo sapiens
    NCBI Accession: NP_002818
    SubstrateDB: 19345
    UniProt Accession: P18031
    [Sequence on/off]
    MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINAS
    LIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNL
    KLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGP
    VVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKF
    IMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEK
    GSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT
    AGAYLCYRFLFNSNT
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: No_information
    Position: No_information
    Protease
    Definition: calpain-1
    Organism: Homo sapiens
    MEROPS ID: MER000770
    PMAP ID: pmap.21406
    MEROPS code: C02.001
    Consequence
    Activation_complete
    Method_of_ID
    Gel electrophoresis
    Original citation
    Comments and others