CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: calcium/calmodulin-dependent protein kinase IV
    Symbol: CAMK4
    Organism: Homo sapiens
    NCBI Accession: NP_001735
    SubstrateDB: 19362
    UniProt Accession: Q16566
    [Sequence on/off]
    MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIVYRCKQKGTQK
    PYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERD
    AADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAP
    EILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKL
    IVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQ
    ESHKASRDPSPIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA
    VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: YWID-GSNR
    Position: 35-36
    Protease
    Definition: caspase-3
    Organism: Homo sapiens
    MEROPS ID: MER000853
    PMAP ID: pmap.22035
    MEROPS code: C14.003
    Cell_line
    SH-SY5Y
    Method_of_ID
    N-terminal sequencing
    Original citation
    Comments and others