CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: coagulation factor II receptor precursor
    Symbol: F2R
    Organism: Homo sapiens
    NCBI Accession: NP_001983
    SubstrateDB: 19446
    [Sequence on/off]
    MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYR
    LVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVY
    MLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMQS
    LSWRTLGRASFTCLAIWALAIAGVVPLVLKEQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFF
    VPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAY
    FAYLLCVCVSSISSCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
    KKLLT
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: No_information
    Position: No_information
    Protease
    Definition: coagulation factor Xa
    Organism: Homo sapiens
    MEROPS ID: MER000212
    PMAP ID: pmap.18066
    MEROPS code: S01.216
    Consequence
    Activation_complete
    Original citation
    Comments and others