CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: connective tissue growth factor
    Symbol: CTGF
    Organism: Homo sapiens
    NCBI Accession: NP_001892
    SubstrateDB: 19456
    UniProt Accession: Q5M8T4
    [Sequence on/off]
    MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTE
    RDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMD
    VRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACS
    KTCGMGISTRVTNDNASCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYR
    AKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: RANC-LVQT
    Position: 199-200
    Protease
    Definition: matrix metallopeptidase-1
    Organism: Homo sapiens
    MEROPS ID: MER001063
    PMAP ID: pmap.41842
    MEROPS code: M10.001
    Method_of_ID
    N-terminal sequencing
    Original citation
    Comments and others