CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: complement component 1, q subcomponent, A chain
    Symbol: C1QA
    Organism: Homo sapiens
    NCBI Accession: CAI22892
    SubstrateDB: 19775
    [Sequence on/off]
    MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQ
    GEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQ
    EEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQ
    QGDQVWVEKDP
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: GIQG-LKGD
    Position: 65-66
    Protease
    Definition: matrix metallopeptidase-2
    Organism: Homo sapiens
    MEROPS ID: MER001080
    PMAP ID: pmap.41911
    MEROPS code: M10.003
    Pathway
    Respiratory burst
    Method_of_ID
    N-terminal sequencing
    Original citation
    Comments and others