CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: matrix metalloproteinase 1 preproprotein
    Symbol: MMP1
    Organism: Homo sapiens
    NCBI Accession: NP_002412
    SubstrateDB: 19812
    UniProt Accession: P03956
    [Sequence on/off]
    MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF
    FGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQL
    WSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREY
    NLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDS
    KLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWA
    VQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
    GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: AQFV-LTEG
    Position: 101-102
    Protease
    Definition: pseudolysin
    Organism: Pseudomonas aeruginosa
    MEROPS ID: MER001024
    PMAP ID: pmap.41738
    MEROPS code: M04.005
    Consequence
    Activation_complete
    Pathway
    Peptidase processing
    Disease
    Bacterial infection
    Method_of_ID
    N-terminal sequencing
    Original citation
    Comments and others