CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: matrix metalloproteinase 26 preproprotein
    Symbol: MMP26
    Organism: Homo sapiens
    NCBI Accession: NP_068573
    SubstrateDB: 19827
    UniProt Accession: Q9NRE1
    [Sequence on/off]
    MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLD
    MQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQ
    QVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEI
    GHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: QLLQ-QFHR
    Position: 59-60
    Size of products 19kDa, 17kDa
    Protease
    Definition: matrix metallopeptidase-26
    Organism: Homo sapiens
    MEROPS ID: MER012072
    PMAP ID: pmap.06772
    MEROPS code: M10.029
    Consequence
    Activation_complete
    Pathway
    Peptidase processing
    Method_of_ID
    N-terminal sequencing
    Original citation
    Comments and others