CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: chemokine (C-X-C motif) ligand 5 precursor
    Symbol: CXCL5
    Organism: Homo sapiens
    NCBI Accession: NP_002985
    SubstrateDB: 21350
    UniProt Accession: P42830
    [Sequence on/off]
    MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFA
    IGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: AVLR-ELRC
    Position: 45-46
    Protease
    Definition: matrix metallopeptidase-1
    Organism: Homo sapiens
    MEROPS ID: MER001063
    PMAP ID: pmap.41842
    MEROPS code: M10.001
    Consequence
    Others
    Method_of_ID
    Mass spectrometry
    Original citation
    Comments and others