CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: prolactin
    Symbol: PRL
    Organism: Homo sapiens
    NCBI Accession: NP_000939
    SubstrateDB: 21567
    UniProt Accession: P01236
    [Sequence on/off]
    MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDK
    RYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAI
    LSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKI
    DNYLKLLKCRIIHNNNC
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: FITK-AINS
    Position: 81-82
    Protease
    Definition: matrix metallopeptidase-1
    Organism: Homo sapiens
    MEROPS ID: MER001063
    PMAP ID: pmap.41842
    MEROPS code: M10.001
    Consequence
    Activation_complete
    Pathway
    angiogenesis
    Tissue
    chondrocyte
    Disease
    Osteoarthritis
    Method_of_ID
    N-terminal sequencing
    Original citation
    Comments and others