CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: growth differentiation factor 5 preproprotein
    Symbol: GDF5
    Organism: Homo sapiens
    NCBI Accession: NP_000548
    SubstrateDB: 25782
    [Sequence on/off]
    MRLPKLLTFLLWYLAWLDLEFICTVLGAPDLGQRPQGTRPGLAKAEAKERPPLARNVFRPGGHSYGGGAT
    NANARAKGGTGQTGGLTQPKKDEPKKLPPRPGGPEPKPGHPPQTRQATARTVTPKGQLPGGKAPPKAGSV
    PSSFLLKKAREPGPPREPKEPFRPPPITPHEYMLSLYRTLSDADRKGGNSSVKLEAGLANTITSFIDKGQ
    DDRGPVVRKQRYVFDISALEKDGLLGAELRILRKKPSDTAKPAAPGGGRAAQLKLSSCPSGRQPASLLDV
    RSVPGLDGSGWEVFDIWKLFRNFKNSAQLCLELEAWERGRAVDLRGLGFDRAARQVHEKALFLVFGRTKK
    RDLFFNEIKARSGQDDKTVYEYLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIA
    PLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQY
    EDMVVESCGCR
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: APLA-TRQG
    Position: 385-386
    Protease
    Definition: matrix metallopeptidase-3
    Organism: Homo sapiens
    MEROPS ID: MER001068
    PMAP ID: pmap.41854
    MEROPS code: M10.005
    Consequence
    Activation_complete
    Pathway
    cellular proliferation, differentiation and regeneration
    Disease
    Brachydactyly type A2
    Method_of_ID
    N-terminal sequencing
    Original citation
    Comments and others