CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: cytokine induced apoptosis inhibitor 1
    Symbol: CIAPIN1
    Organism: Homo sapiens
    NCBI Accession: NP_064709
    SubstrateDB: 27226
    [Sequence on/off]
    MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPG
    STTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEV
    QSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSM
    DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLG
    DAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: IDSD-ELLD
    Position: 216-217
    Protease
    Definition: granzyme B (Homo sapiens-type)
    Organism: Homo sapiens
    MEROPS ID: MER000168
    PMAP ID: pmap.17497
    MEROPS code: S01.010
    Consequence
    Unknown
    Pathway
    Apoptosis
    Disease
    Viral infection, Cancer
    Method_of_ID
    Mass spectrometry
    Original citation
    Comments and others