CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • Substrate
    Definition: Digestion PgAFP
    Symbol: PgAFP
    Organism: P. chrysogenum
    NCBI Accession: GQ911150
    SubstrateDB: 27246
    [Sequence on/off]
    LSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKKCKSDRHHCEYDEHHKRVDCQTPV
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: No_information
    Position: No_information
    Protease
    Definition: cationic trypsin
    Organism:
    Original citation
    No_information
    Comments and others