CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_a_predicted.
    Substrate
    Definition: Subtilisin
    Symbol: SUB
    [Sequence on/off]
    MNYKLKENVPPNEDVDIYEKLKTCVINRNVEDFYEECVSTFLEKVKNIGDTNHIICHDNYSDIINFFYLN
    LFVDNSEFVRVVAVSQDNNENAKICKRYIHDKNEKDVTEKSELLQELGLYLKNIKLKYSEKLKKIKNVII
    DNISTCQKCIMIYYFLQKKLVEKISSNINKKDDNVTNIIKKEIFEFNFYRIINKITCPIGYNNVDSVILE
    LMLNGSKIFQMDLNYILEYNKINKVNLKIFKEKFINYDNDEIYRIIKEYVDYDSLIFFCNLLFKEFKRMK
    NLLLQNDNYNNGNDTSIINENISNNNNNNNNNNNDPLCNDNTLYNYNIQCLLPYIYIHIFILLKHKQVEE
    TVRRVLKERIILYSLMINSLRYSDNFIQLIIFKIINNIFINEEEFLKDSNKKLISSIFSYWIKLSDGCIV
    KMINASITDESSTSHNNLSRSSSNNTKHNSNKLYNNSCIKKTKTDDENFLKNNFTDYDIYKYMQSLICGL
    YLLTLIRKKKNNDHHYNNKSDNTNQFSSLKEYNIDMLSLNHFFINMDNYIYLIGFMFSENKDTINNLFNL
    IFKLLYFIKYLKSYIIQNRNLKNKYFEDTCIYSSINILYNILEVTKKFFISYFRIDEYTKNLYKNYFRDR
    PLTFENMAFYVIPLFINHEDYYIRIYSIKILIILLSDTNIRDSLDKKNLFRIFDLLINIEGYKSLSQDEE
    EEEKKNINQLLLLLFKCNINDNKLSSNITNLIFSEKQKIFIKYILRLCKDEEYSIIHMKNFFDYFFVLLV
    KLINIIIRRAQCSLNIEKYKDFFMNIYEVVEIFMKELKKEKLKKHKLLFLSSGIYLCHLITNSIYKGKIH
    SSVPYLNVVISLIKNIEHHLNFIQDDLIYINKISKDIISDKKLSIHSEDEDNKDDDSKSVKDLHVLYFYN
    NVYSEELGKNVGNNNNMANNNNNDNNDNNINNNNNNNNGENIEHKCVKSTYKENKNNDINCKNKQTNDKN
    LKSNPSDNKGTNNSEIVKKLNKYDKFMKMCLLQNKNNDEIIYNYINCLFYLCVSNMNKRTRKNVIKSYDL
    VVKYILKDEYKLHRVKKKSLLFSMPIYIIRDVENEGKRYNLIIDKYDYILRSYIIDFFKCKKYLPCLLLS
    CLSFTNTMILFLKKKNFINSTTNNNITEKEDMLDCFMLVNSKTWFYFNVLVECICDYFMTSQSKMDVKSQ
    QIKEQQNEHTQKCNNKNKNNNNNNNNDDDDVHKFSWQIINLIIDSIWKILIYIFYNIKINIFSIKVKTFS
    INIYGRAALLMFLQFYESWIVFIKTFLTSEKQIFISRNILLPDLFYKKFGFLSSQILSYFHFIESNFFVD
    SQNEVNLRLLEKQKDVMNNILDVLIYFIKDKDPKGYVNELNSFSQFKLRIKKLTFPKKLQDGFLSCTYDH
    LFKKAKELLLRVEKSKTLQMDECRGEDPNINSNSLQMDKGDDNENVININNSDIIVEKDSKTIIRIDSNS
    KDANAVERDDNKEGKKVFSLEQAKKIIEKNAASKNTKRAIVLNENLAEKNKQQIFKEMKEKRKEAENILM
    KYFIMIQEFLNWDFFNLDNIDKYKNSISEELPIRFENEEEYHKFFRPMALEECRCSMLNNMMGDINKYVI
    SIVGKKKMPYWVVWHVSSSSENKRNLDNIKPMDLIALIPYDEDRNNNTHADNNDTSIKYDKLKDMLKCTK
    HVIGLVDIGSNKFDNIFDIKLINEDNLPSKVNNEKTRLKLNFITCNKFHAYVLCNLMTNIREFQSIYLSR
    NCPLFNLILNPVGENKVEKGLCNMNINNNYINDCDKDKNDKLKKELEKLTRQEKLILKILSKYNLLNKSQ
    IEAVKLILLNKNNISLIQGPPGTGKTKTVIGIVSVLYALLYKKNYEKDKKKKDLLYNEQINNTKKKKKIL
    VCSPSNSAIDEIAKRILNEGLLNFTNLINSYENKIKKNNITSQKCGSNNKKKILLGDNDLYNSSDISDFL
    GEDQPSNFSNDKKEKSSKGMVLLKGLKNVDKLNNNNISSEKMNQFKKQTIAPKCIRIGLSKRTHEEIQRI
    SLDYIFNKKKSSDENLYHVHFEKRKSKLTYSIEAVDYTKLKINEMKNDLSLNNSEKYSFDCNDINGKFMF
    QKVEFIERFFSDEYINNLDKKYLENLLYLYNESSSHYDWSIQKLISERNYLDECMTRLIETDEQIGSFYT
    SNNKENMLFDSEIIFSTLSGSASPVIENLEFEYLIIDEACQCVELSCLIPFRLKVKNIIMVGDPKQLPAT
    TFSSDCRKYGYSRSLFERLLLCNVSSVLLNIQYRMRPEICYFPNNYFYNGLIKNADILSNKPFFYYFQDL
    DFFGCYKFINIDGIESMTYNKSYINYVEAYFIYKLVLYIKNIISKHQDHTKSVPNLYKLPVHFSLKDIGI
    ICPYQSQVHLIRNMFEESFEDKIPFPEVSTVDAFQGREKHIIIFSCVRSKLEVLENSKLLHKMGTYKKAD
    DKWKKTKERYVIYDSDDNAEYSMNENEDNSDNDDDNDDDNDNDDDNNKEWKYDYNDGVHTKKWISSKMPN
    IKNENDFRAIQKFGNNIGFLKDERRLNVALTRAKDYLWIIGNRKNLEMNETWDCLIQNAIIRKCYLDLKI
    NFENSTTENIIKEKVNDFFIHLENDINEKKYESSEMSSNLSSNSCIIKEEHDEEENYDEIIVDDDKLFKN
    KNKFRLNKNKYKQNTIWNNSGDNEFSFSRAYTGNSYWSNYSNKEREKNKNYDKKGKRKINDSLLDDDLLT
    KRRKYDPYDNSNV
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: No_information
    Position: No_information
    Protease
    Definition:
    Organism: Plasmodium falciparum (isolate 311)
    Cell_compartment
    Cytosol; Plasma membrane; Nucleus; Unknown;
    Original citation
    No_information
    Comments and others