CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_a_predicted.
    Substrate
    Definition: Crotalicidin
    Symbol: Ctn1 AB
    Organism: snake
    SubstrateDB: 27251
    [Sequence on/off]
    KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: No_information
    Position: No_information
    Protease
    Definition: elastase
    Organism:
    Original citation
    No_information
    Comments and others