CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: H2TKD
    Symbol:
    Organism: Homo sapiens
    SubstrateDB: 27252
    [Sequence on/off]
    MSYYHHHHHHDYDIPTTENLYFQGAMGAQMRILKETELRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAI
    KVLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDL
    LNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALE
    SILRRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMID
    SECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDAEEYLV
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: NEDL-GPAS, EDLG-PASP, LGPA-SPLD, ASPL-DSTF
    Position: No_information
    Protease
    Definition:
    Organism: Saccharomyces cerevisiae
    Consequence
    Others
    Cell_compartment
    Unknown;
    Original citation
    No_information
    Comments and others