CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Receptor (tnfrsf)-interacting serine-threonine kinase 1
    Symbol: RIPK1
    Organism: Homo sapiens
    SubstrateDB: 27253
    UniProt Accession: Q13546
    [Sequence on/off]
    MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRL
    RHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLK
    PENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSD
    VYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPG
    IEEKFRPFYLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLG
    MGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF
    AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWY
    RPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDST
    NTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQ
    MLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: LQLD-CVAV
    Position: 324-325
    Protease
    Definition: caspase-6
    Organism: Homo sapiens
    UniProt AC: P55212
    MEROPS code: C14.005
    Consequence
    Inactivation_complete
    Pathway
    Necroptosis, NF-kB, TNFa
    Cell_compartment
    Cytosol;
    Tissue
    T-lymphocyte
    Cell_line
    Jurkat
    Method_of_ID
    Gel electrophoresis
    Original citation
    Relevance
    A
    Comments and others