CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • Substrate
    Definition: endo-alpha-N-acetylgalactosaminidase
    Symbol: EngBF
    [Sequence on/off]
    MKKKKTISAALATALALTCMGSGGGTAFAVPLSDADLQTLASQIQQINDTSDSATASETPSAQADAVEGW
    TIDSNIAQGGEILEMANGWLHLKSTASNGNAAANPSSSNNWPAVAVWGTDYDFSKAGSFHATIKSPQEGS
    ANRFGFYLGYNDPGSGLFIGYDSGGWFWQTYTGGGSGSWYSGARIAAPSANEEHDIRVSWTDAKVATLTV
    DGQKAFDVDYSAMTNLSNKLAIKAGSWKELNEVTDVYIKDFPEVVEAAKHAVSGKVVDAGGAAIEGATVR
    LDKTKVKTGADGTFSFADIEEGEHTLSIAKEGYEDVSQQVTVSGADLAIDPITLNKTVQVASETLKTKKM
    EVQIKKNFPSVLQYTMTDGKVMYGQSKDVRTVEINGTNIELGDDDVTFKKVSDTEATYTLKVKDEAKKID
    AVITVQITVKANQLHLNVTKIKNNLSEGIPEGNGVEENAIQTLSFPNQSLVSVRSSQENAQFTGARMSSN
    TQKPGDTNFAVTEDTNVTDSDYTYGFISGAGLSAGLWSNSEHDGTYVAAPVRGGSQNTRVYATTQQTGDA
    TSLGLASAPWYYHRTVTDSKGKKYTVAETALPQMAVAIAGDENEDGAVNWQDGAIAYRDIMNNPYKSEEV
    PELVAWRIAMNFGSQAQNPFLTTLDNVKKVALNTDGLGQSVLLKGYGNEGHDSGHPDYGDIGQRLGGADD
    MNTMMEEGSKYGARFGVHVNASEMYPEAKAFSEDMVRRNSAGGLSYGWNWLDQGVGIDGIYDLASGSRVS
    RFADLSKEVGDNMDFIYLDVWGNLTSSGSEDSWETRKMSKMINDNGWRMTTEWGSGNEYDSTFQHWAADL
    TYGGYTSKGENSEVMRFLRNHQKDSWVGDYPQYGGAANAPLLGGYNMKDFEGWQGRNDYAAYIKNLYTHD
    VSTKFIQHFKVTRWVNNPLLTADNGNAAAVSDPNTNNGNEQITLKDSNGNVVVVSRGSNDTSSAAYRQRT
    ITFNGVKVASGVVSAGDGSATGDESYLLPWMWDSFTGKLVKDSEQKLYHWNTKGGTTTWTLPDSWKNLSS
    VKVYQLTDQGKTNEQTVAVSGGKVTLTADAETPYVVYKGEAKQIQVNWSEGMHVVDAGFNGGSNTLTDNW
    TVSGSGKAEVEGDNNAMLRLTGKVDVSQRLTDLKAGQKYALYVGVDNRSTGDASVTVTSGGKVLATNSTG
    KSIAKNYIKAYGHNTNSNTENGSSYFQNMYVFFTAPENGDATVTLSHKSTDGAHTYFDDVRIVENQYSGI
    TYEKDGTLKSLTNGFENNAQGIWPFVVSGSEGVEDNRIHLSELHAPFTQAGWDVKKMDDVLDGTWSVKVN
    GLTQKGTLVYQTIPQNVKFEAGAKYKVSFDYQSGSDDIYAIAVGQGEYSAGSVKLTNLKKALGETGKAEF
    ELTGGVNGDSWFGIYSTATAPDLQGSTGNAQDFGGYKDFVLDNLKIERIESQTRTKAEAQDKVKEIRGKY
    DSKRAELSDAAWQQYQDTLVKARVLINKNGATAEDFTKAYDILVALDEYMKTAPGNESSDKYDVAADGSD
    ELGGYTVATGSEEPTAGLPSEGPADLAQDGNDSTHWHTSWSENAVGNGTAWYQFNLNEPTTINGLRYLPR
    SGGMNANGKIKGYKITLTLADGTTKDVVTDAEFSTTTMWQKASFDAVENVTAVRLTVLSSAGQSDSQANK
    FASAAELRLTTDREVEEETVAPDKTDLNDTIAKANGLKESDYTAESWTALVKAREAAQAVADNDKATAYD
    VALALTNLESAIAGLEKTGEEPGPGPVEVNKTDLQTAVNKASKLEKADYTTNSWEAFAEALKAAQQVLDN
    KNATQQDVDTALSALQDAISKLEAATEPKPNPEPGVVDKAALNATINKAAAINLGLYTDDSANALRAALK
    KAREVSDNSNATQKQVDAAREALEKAIAALVKRPAAKGDGNVVSNTGSDVATIALAGLLLAGAGAAIAYR
    RNREQL
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: No_information
    Position: No_information
    Protease
    Definition:
    Organism:
    Original citation
    No_information
    Comments and others