CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • Substrate
    Definition: CD200 antigen isoform a precursor
    Symbol: CD200
    Organism: Homo sapiens
    NCBI Accession: NP_005935.4
    SubstrateDB: 27259
    [Sequence on/off]
    MERLVIRMPFSHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAV
    SPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVY
    VQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGK
    EVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: No_information
    Position: No_information
    Protease
    Definition: ADAM28 peptidase
    Organism: Homo sapiens
    MEROPS ID: MER005495
    PMAP ID: pmap.12422
    MEROPS code: M12.020
    Consequence
    Unknown
    Cell_compartment
    Cytosol; Plasma membrane;
    Original citation
    No_information
    Comments and others