CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Endothelin 1
    Symbol: EDN1
    Organism: Homo sapiens
    NCBI Accession: NP_001946
    SubstrateDB: 3058
    [Sequence on/off]
    MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLD
    IIWVNTP
    EHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWN
    NHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRA
    HW
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: DIIW-VNTP
    Position: 73-74
    Protease
    Definition: Kell blood-group protein
    Organism: Homo sapiens
    NCBI GI: 4557691
    MEROPS ID: MER001054
    PMAP ID: pmap.41807
    MEROPS code: M13.090
    Original citation
    Acknowledgment
    HPRD
    Comments and others