CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Bh3 interacting domain death agonist isoform 2
    Symbol: BID
    Organism: Homo sapiens
    NCBI Accession: NP_001187
    SubstrateDB: 3066
    UniProt Accession: P55957
    [Sequence on/off]
    MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLG
    RIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPR
    DMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: WEGY-DELQ
    Position: 54-55
    Protease
    Definition: calpain-1
    Organism: Homo sapiens
    NCBI GI: 12408656
    MEROPS ID: MER000770
    PMAP ID: pmap.21406
    MEROPS code: C02.001
    Original citation
    Acknowledgment
    HPRD
    Comments and others