CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Serum amyloid a2
    Symbol: SAA2
    Organism: Homo sapiens
    NCBI Accession: NP_110381
    SubstrateDB: 3212
    [Sequence on/off]
    MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGA
    WAAEVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY

    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: AAEV-ISNA
    Position: 75-76
    Protease
    Definition: matrix metallopeptidase-1
    Organism: Homo sapiens
    NCBI GI: 4505215
    MEROPS ID: MER001063
    PMAP ID: pmap.41842
    MEROPS code: M10.001
    Original citation
    Acknowledgment
    HPRD
    Comments and others