CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Syndecan 1 precursor
    Symbol: SDC1
    Organism: Homo sapiens
    NCBI Accession: NP_002988
    SubstrateDB: 3216
    UniProt Accession: P18827
    [Sequence on/off]
    MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQL
    LTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEATPRPRETTQLPTTHQASTT
    TATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHTEDGGPSATERAAEDGASSQLPAAEGSGEQD
    FTFETSGENTAVVAVEPDRRNQSPVDQGATGASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKK
    KDEGSYSLEEPKQANGGAYQKPTKQEEFYA
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: ASQG-LLDR
    Position: 245-246
    Protease
    Definition: matrix metallopeptidase-1
    Organism: Homo sapiens
    NCBI GI: 4505215
    MEROPS ID: MER001063
    PMAP ID: pmap.41842
    MEROPS code: M10.001
    Original citation
    Acknowledgment
    HPRD
    Comments and others