CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Serum amyloid a2
    Symbol: SAA2
    Organism: Homo sapiens
    NCBI Accession: NP_110381
    SubstrateDB: 3232
    [Sequence on/off]
    MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGA
    WAA
    EVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: GPGG-AWAA
    Position: 69-70
    Protease
    Definition: matrix metallopeptidase-2
    Organism: Homo sapiens
    NCBI GI: 11342666
    MEROPS ID: MER001080
    PMAP ID: pmap.41911
    MEROPS code: M10.003
    Original citation
    Acknowledgment
    HPRD
    Comments and others