CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Serpin peptidase inhibitor, clade a, member 3 precursor
    Symbol: SERPINA3
    Organism: Homo sapiens
    NCBI Accession: NP_001076
    SubstrateDB: 3382
    UniProt Accession: P01011
    [Sequence on/off]
    MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPD
    KNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNA
    MFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLINDYVKNGTRGKITDLIKDLDSQTMMVLVNY
    IFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILPD
    QDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGAR
    NLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP
    KQA
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: ITLL-SALV
    Position: 383-384
    Protease
    Definition: kallikrein hK2
    Organism: Homo sapiens
    NCBI GI: 5031829
    MEROPS ID: MER000094
    PMAP ID: pmap.16944
    MEROPS code: S01.161
    Consequence
    Neutral
    Method_of_ID
    N-terminal sequencing
    Original citation
    Acknowledgment
    HPRD
    Comments and others