CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Insulin-like growth factor binding protein 3 isoform b precursor
    Symbol: IGFBP3
    Organism: Homo sapiens
    NCBI Accession: NP_000589
    SubstrateDB: 3423
    UniProt Accession: P17936
    [Sequence on/off]
    MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCC
    LTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASES
    EEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEY
    GPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGK
    EDVHCYSMQSK
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: SRLR-AYLL
    Position: 124-125
    Protease
    Definition: plasmin
    Organism: Homo sapiens
    NCBI GI: 4505881
    MEROPS ID: MER000175
    PMAP ID: pmap.17524
    MEROPS code: S01.233
    Original citation
    Acknowledgment
    HPRD
    Comments and others