CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Insulin-like growth factor binding protein 5
    Symbol: IGFBP5
    Organism: Homo sapiens
    NCBI Accession: NP_000590
    SubstrateDB: 3556
    UniProt Accession: P24593
    [Sequence on/off]
    MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCALAEGQSCGVY
    TERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPK
    HTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMV
    PRAVYLPNCDRKGFYKRKQCKPSRGRKRGICWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: AHPR-IISA
    Position: 176-177
    Protease
    Definition: thrombin
    Organism: Homo sapiens
    NCBI GI: 4503635
    MEROPS ID: MER000188
    PMAP ID: pmap.17562
    MEROPS code: S01.217
    Original citation
    Acknowledgment
    HPRD
    Comments and others