CutDB: a proteolytic event database
  • User: anonymous [ Log in ]
  • This_entry_is_based_on_an_experiment.
    Substrate
    Definition: Coagulation factor ii receptor precursor
    Symbol: F2R
    Organism: Homo sapiens
    NCBI Accession: NP_001983
    SubstrateDB: 3568
    [Sequence on/off]
    MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYR
    LVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVY
    MLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMQS
    LSWRTLGRASFTCLAIWALAIAGVVPLVLKEQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFF
    VPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAY
    FAYLLCVCVSSISSCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
    KKLLT
    ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
    Cut-site
    Sequence: LDPR-SFLL
    Position: 41-42
    Protease
    Definition: thrombin
    Organism: Homo sapiens
    NCBI GI: 4503635
    MEROPS ID: MER000188
    PMAP ID: pmap.17562
    MEROPS code: S01.217
    Original citation
    Acknowledgment
    HPRD
    Comments and others